PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G380100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 360aa    MW: 39478.1 Da    PI: 8.5461
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G380100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.83e-55181481128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka..eekewyfFskrdkkyatgkrknratksgyWkatg 87 
                         lppGfrFhPtdeel+ +yL++kv+++++ + ++i +vd++k+ePw+Lp+  k++a  + kewyf+++rd+ky+tg+r+nrat++gyWkatg
  Brast01G380100.1.p  18 LPPGFRFHPTDEELIIFYLNPKVSNRSFCT-RAIGDVDMNKCEPWELPAkaKMTAgnDMKEWYFYCHRDRKYPTGHRTNRATQAGYWKATG 107
                         79*************************988.89**************9535333333666******************************* PP

                 NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         kdke+++  + l+g+kktLvfykgrap+gekt+Wvmheyr+
  Brast01G380100.1.p 108 KDKEIFRPPSVLIGMKKTLVFYKGRAPRGEKTNWVMHEYRM 148
                         ***************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-619187IPR003441NAC domain
PROSITE profilePS5100558.03618187IPR003441NAC domain
PfamPF023652.9E-2819148IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MGDMQQQQQH LQQGQLDLPP GFRFHPTDEE LIIFYLNPKV SNRSFCTRAI GDVDMNKCEP  60
WELPAKAKMT AGNDMKEWYF YCHRDRKYPT GHRTNRATQA GYWKATGKDK EIFRPPSVLI  120
GMKKTLVFYK GRAPRGEKTN WVMHEYRMES SSNNNNENKV LSFLPTAKVT NPSSLKDEWV  180
VCRIFHKTTG IKKLVVPSYP MGPVAMGDQQ QGFGSSTAAC IQTQLQPPPM AMGCMDPSAL  240
YGTTGAGASS SYQLPPPMAM AMGNAPEPAP ALPMNGLFFG TQLQAPQPPA PMSFYQQHMQ  300
LQMGHAGDQG FIASGPSSMV SQSQDDAAGV SNAAAATEIS SVEMAGGIDG LGMWKFPKY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-501519314171NO APICAL MERISTEM PROTEIN
1ut4_B5e-501519314171NO APICAL MERISTEM PROTEIN
1ut7_A5e-501519314171NO APICAL MERISTEM PROTEIN
1ut7_B5e-501519314171NO APICAL MERISTEM PROTEIN
4dul_A5e-501519314171NAC domain-containing protein 19
4dul_B5e-501519314171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565350.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
SwissprotQ9FLR33e-77NAC79_ARATH; NAC domain-containing protein 79
TrEMBLA0A0Q3FU070.0A0A0Q3FU07_BRADI; Uncharacterized protein
STRINGBRADI2G03450.12e-94(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP145237121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07680.21e-74NAC domain containing protein 80